Discover the toolingbehind modern intelligence
The operating system for AI infrastructure discovery. Search a live map of MCP servers, AI agents, LLM tools, automation systems, and developer infrastructure.
Vikshep
high-performance, domain-agnostic mathematical engine for computing the Wavelet Scattering Transform (WST) of non-stationary 1-D time-series data.
16stars
0forks
Python
agentic-aiaiastrophysicsmathematicswavelet-transform
Quality signals
ActiveNo testsNo CIThin docsNo licenseNew
InstallMCPRun via uvx (Python)
Universal installANY TOOL
$ npx skillcity@latest samvardhan03/VikshepAuto-detects the skill or MCP server in this repo and installs it for Claude Code, Codex, Cursor, Cline, OpenCode, Gemini CLI, Anti-Gravity, OpenClaw and Hermes.
Requires Node.js 18+ (ships with npx).
Or install manually
uvx vikshep
MCP Configuration
Add this to your claude_desktop_config.json
{
"mcpServers": {
"vikshep": {
"command": "uvx",
"args": [
"vikshep"
]
}
}
}Loading README…
Ask a simulated agent to run this skill. It loads the real SKILL.md and reasons over your task with NVIDIA.
vikshep — sandboxAI sandbox
Pick a quick prompt below or type your own — watch the agent execute this skill step by step.
guest@skillcity:~$Try a prompt